OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF113A (NM_006978) Human Mass Spec Standard

Be the first to review this product
SKU
PH304528
RNF113A MS Standard C13 and N15-labeled recombinant protein (NP_008909)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335670 Rabbit Polyclonal Anti-RNF113A Antibody
100 ul
$585.00
LY416295 Transient overexpression lysate of ring finger protein 113A (RNF113A) (as WB positive control) 100 ug
$436.00

Other products for "RNF113A or NM_006978"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204528
Predicted MW 38.6 kDa
Protein Sequence
Protein Sequence
>RC204528 representing NM_006978
Red=Cloning site Green=Tags(s)

MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKRVTHNPMIQKT
RDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKI
QEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGF
CGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHY
FCESCALQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008909
RefSeq Size 1349
RefSeq ORF 1029
Synonyms Cwc24; RNF113; TTD5; ZNF183
Locus ID 7737
UniProt ID O15541
Cytogenetics Xq24
Summary This intronless gene encodes a protein which contains a C3H1-type zinc finger domain and a C3HC4 Ring-type (Really Interesting New Gene-type) zinc finger domain. The Ring-type zinc finger domain is identified in various tumor suppressors, DNA repair genes and cytokine receptor-associated molecules, and is probably involved in mediating protein-protein interactions. provided by RefSeq, May 2010
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF113A" proteins (3)
SKU Description Size Price
LC416295 Lyophilized RNF113A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416295 Transient overexpression lysate of ring finger protein 113A (RNF113A) (as WB positive control) 100 ug
$436.00
TP304528 Recombinant protein of human ring finger protein 113A (RNF113A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products