OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PYCR2 (NM_013328) Human Mass Spec Standard

Be the first to review this product
SKU
PH304525
PYCR2 MS Standard C13 and N15-labeled recombinant protein (NP_037460)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501877 PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10) 100 ul
$447.00
LY402246 Transient overexpression lysate of pyrroline-5-carboxylate reductase family, member 2 (PYCR2) (as WB positive control) 100 ug
$436.00

Other products for "PYCR2 or NM_013328"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204525
Predicted MW 33.6 kDa
Protein Sequence
Protein Sequence
>RC204525 protein sequence
Red=Cloning site Green=Tags(s)

MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV
KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH
ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL
LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA
ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037460
RefSeq Size 1771
RefSeq ORF 960
Synonyms HLD10; P5CR2
Locus ID 29920
UniProt ID Q96C36
Cytogenetics 1q42.12
Summary This gene belongs to the pyrroline-5-carboxylate reductase family. The encoded mitochondrial protein catalyzes the conversion of pyrroline-5-carboxylate to proline, which is the last step in proline biosynthesis. Alternatively spliced transcript variants have been described for this gene. provided by RefSeq, Nov 2012
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PYCR2" proteins (3)
SKU Description Size Price
LC402246 Lyophilized PYCR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402246 Transient overexpression lysate of pyrroline-5-carboxylate reductase family, member 2 (PYCR2) (as WB positive control) 100 ug
$436.00
TP304525 Recombinant protein of human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products