PYCR2 (NM_013328) Human Mass Spec Standard

SKU
PH304525
PYCR2 MS Standard C13 and N15-labeled recombinant protein (NP_037460)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204525]
Predicted MW 33.6 kDa
Protein Sequence
Protein Sequence
>RC204525 protein sequence
Red=Cloning site Green=Tags(s)

MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV
KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH
ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL
LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA
ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037460
RefSeq Size 1771
RefSeq ORF 960
Synonyms HLD10; P5CR2
Locus ID 29920
UniProt ID Q96C36
Cytogenetics 1q42.12
Summary This gene belongs to the pyrroline-5-carboxylate reductase family. The encoded mitochondrial protein catalyzes the conversion of pyrroline-5-carboxylate to proline, which is the last step in proline biosynthesis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012]
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:PYCR2 (NM_013328) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402246 PYCR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402246 Transient overexpression lysate of pyrroline-5-carboxylate reductase family, member 2 (PYCR2) 100 ug
$436.00
TP304525 Recombinant protein of human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.