RTKN (NM_033046) Human Mass Spec Standard

SKU
PH304517
RTKN MS Standard C13 and N15-labeled recombinant protein (NP_149035)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204517]
Predicted MW 61.2 kDa
Protein Sequence
Protein Sequence
>RC204517 protein sequence
Red=Cloning site Green=Tags(s)

MQDRLHILEDLNMLYIRQMALSLEDTELQRKLDHEIRMREGACKLLAACSQREQALEATKSLLVCNSRIL
SYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLL
QLGEHIQDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGR
SSGRRVRASLDSAGGSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLY
GSVCCRLAAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKE
TRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIMKIET
PAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAP
APDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149035
RefSeq Size 2638
RefSeq ORF 1650
Locus ID 6242
UniProt ID Q9BST9
Cytogenetics 2p13.1
Summary This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RTKN (NM_033046) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318810 RTKN MS Standard C13 and N15-labeled recombinant protein (NP_001015055) 10 ug
$3,255.00
LC403228 RTKN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423121 RTKN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403228 Transient overexpression lysate of rhotekin (RTKN), transcript variant 2 100 ug
$436.00
LY423121 Transient overexpression lysate of rhotekin (RTKN), transcript variant 1 100 ug
$665.00
TP304517 Recombinant protein of human rhotekin (RTKN), transcript variant 2, 20 µg 20 ug
$737.00
TP318810 Recombinant protein of human rhotekin (RTKN), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.