CD32B (FCGR2B) (NM_001002275) Human Mass Spec Standard

SKU
PH304496
FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002275)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204496]
Predicted MW 33.8 kDa
Protein Sequence
Protein Sequence
>RC204496 representing NM_001002275
Red=Cloning site Green=Tags(s)

MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLT
CRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHP
EFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV
TITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDE
ADKVGAENTITYSLLMHPDALEEPDDQNRI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002275
RefSeq Size 1630
RefSeq ORF 930
Synonyms CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2
Locus ID 2213
UniProt ID P31994
Cytogenetics 1q23.3
Summary The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus
Write Your Own Review
You're reviewing:CD32B (FCGR2B) (NM_001002275) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319569 FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002273) 10 ug
$3,255.00
LC400365 FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC401309 FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424200 FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424201 FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434147 FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400365 Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4 100 ug
$436.00
LY401309 Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 1 100 ug
$436.00
LY424200 Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2 100 ug
$436.00
LY424201 Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 3 100 ug
$436.00
LY434147 Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 5 100 ug
$436.00
TP304496 Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4, 20 µg 20 ug
$737.00
TP319569 Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2, 20 µg 20 ug
$737.00
TP720664 Purified recombinant protein of Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.