CD84 (NM_003874) Human Mass Spec Standard

SKU
PH304477
CD84 MS Standard C13 and N15-labeled recombinant protein (NP_003865)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204477]
Predicted MW 36.9 kDa
Protein Sequence
Protein Sequence
>RC204477 protein sequence
Red=Cloning site Green=Tags(s)

MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET
APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS
LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ
LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYD
EILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003865
RefSeq Size 8245
RefSeq ORF 984
Synonyms hCD84; LY9B; mCD84; SLAMF5
Locus ID 8832
UniProt ID Q9UIB8
Cytogenetics 1q23.3
Summary This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:CD84 (NM_003874) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401277 CD84 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432804 CD84 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432917 CD84 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401277 Transient overexpression lysate of CD84 molecule (CD84) 100 ug
$436.00
LY432804 Transient overexpression lysate of CD84 molecule (CD84), transcript variant 3 100 ug
$436.00
LY432917 Transient overexpression lysate of CD84 molecule (CD84), transcript variant 1 100 ug
$436.00
TP304477 Recombinant protein of human CD84 molecule (CD84), 20 µg 20 ug
$737.00
TP329804 Purified recombinant protein of Homo sapiens CD84 molecule (CD84), transcript variant 3, 20 µg 20 ug
$737.00
TP723970 Human SLAMF5 Protein, mFc-His Tag 100 ug
$565.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.