CD84 (NM_003874) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204477] |
Predicted MW | 36.9 kDa |
Protein Sequence |
Protein Sequence
>RC204477 protein sequence
Red=Cloning site Green=Tags(s) MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYD EILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003865 |
RefSeq Size | 8245 |
RefSeq ORF | 984 |
Synonyms | hCD84; LY9B; mCD84; SLAMF5 |
Locus ID | 8832 |
UniProt ID | Q9UIB8 |
Cytogenetics | 1q23.3 |
Summary | This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC401277 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432804 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432917 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401277 | Transient overexpression lysate of CD84 molecule (CD84) | 100 ug |
$436.00
|
|
LY432804 | Transient overexpression lysate of CD84 molecule (CD84), transcript variant 3 | 100 ug |
$436.00
|
|
LY432917 | Transient overexpression lysate of CD84 molecule (CD84), transcript variant 1 | 100 ug |
$436.00
|
|
TP304477 | Recombinant protein of human CD84 molecule (CD84), 20 µg | 20 ug |
$737.00
|
|
TP329804 | Purified recombinant protein of Homo sapiens CD84 molecule (CD84), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP723970 | Human SLAMF5 Protein, mFc-His Tag | 100 ug |
$565.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.