TAK1 (MAP3K7) (NM_003188) Human Mass Spec Standard

SKU
PH304454
MAP3K7 MS Standard C13 and N15-labeled recombinant protein (NP_003179)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204454]
Predicted MW 64 kDa
Protein Sequence
Protein Sequence
>RC204454 representing NM_003188
Red=Cloning site Green=Tags(s)

MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESE
RKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQG
VAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKC
DVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEI
VKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLES
KLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTG
TEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSK
ESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQ
CKKQLEVIRSQQQKRQGTS

TRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003179
RefSeq Size 2912
RefSeq ORF 1737
Synonyms CSCF; FMD2; MEKK7; TAK1; TGF1a
Locus ID 6885
UniProt ID O43318
Cytogenetics 6q15
Summary The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Adherens junction, MAPK signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Wnt signaling pathway
Write Your Own Review
You're reviewing:TAK1 (MAP3K7) (NM_003188) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407927 MAP3K7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407928 MAP3K7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418841 MAP3K7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407927 Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 (MAP3K7), transcript variant B 100 ug
$665.00
LY407928 Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 (MAP3K7), transcript variant C 100 ug
$665.00
LY418841 Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 (MAP3K7), transcript variant A 100 ug
$436.00
TP304454 Recombinant protein of human mitogen-activated protein kinase kinase kinase 7 (MAP3K7), transcript variant A, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.