Caspase 3 (CASP3) (NM_032991) Human Mass Spec Standard

SKU
PH304444
CASP3 MS Standard C13 and N15-labeled recombinant protein (NP_116786)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204444]
Predicted MW 31.6 kDa
Protein Sequence
Protein Sequence
>RC204444 protein sequence
Red=Cloning site Green=Tags(s)

MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD
AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT
NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK
DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116786
RefSeq Size 2522
RefSeq ORF 831
Synonyms CPP32; CPP32B; SCA-1
Locus ID 836
UniProt ID P42574
Cytogenetics 4q35.1
Summary The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protease
Protein Pathways Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, Huntington's disease, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Parkinson's disease, Pathways in cancer, Viral myocarditis
Write Your Own Review
You're reviewing:Caspase 3 (CASP3) (NM_032991) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323662 CASP3 MS Standard C13 and N15-labeled recombinant protein (NP_004337) 10 ug
$3,255.00
LC403215 CASP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418048 CASP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418048 Transient overexpression lysate of caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant alpha 100 ug
$436.00
TP304444 Recombinant protein of human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta, 20 µg 20 ug
$867.00
TP323662 Recombinant protein of human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant alpha, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.