Rad9 (RAD9A) (NM_004584) Human Mass Spec Standard

SKU
PH304439
RAD9A MS Standard C13 and N15-labeled recombinant protein (NP_004575)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204439]
Predicted MW 42.5 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC204439
Blue=ORF Red=Cloning site Green=Tag(s)

MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQAATPGQD
LLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDP
ASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHEEEADSTAKAMVTEMCLGEEDFQQL
QAQEGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLG
SPERHQPVPQLQAHSTPHPDDFANDDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEED
EAEPSTVPGTPPPKKFRSLFFGSILAPVRSPQGPSPVLAEDSEGEG

myc-FLAG tag

Recombinant protein using RC204439 also available, TP304439
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004575
RefSeq Size 2128
RefSeq ORF 1173
Synonyms RAD9
Locus ID 5883
UniProt ID Q99638
Cytogenetics 11q13.2
Summary This gene product is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair. This protein possesses 3' to 5' exonuclease activity, which may contribute to its role in sensing and repairing DNA damage. It forms a checkpoint protein complex with RAD1 and HUS1. This complex is recruited by checkpoint protein RAD17 to the sites of DNA damage, which is thought to be important for triggering the checkpoint-signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:Rad9 (RAD9A) (NM_004584) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401451 RAD9A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401451 Transient overexpression lysate of RAD9 homolog A (S. pombe) (RAD9A) 100 ug
$436.00
TP304439 Recombinant protein of human RAD9 homolog A (S. pombe) (RAD9A), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.