UBE2Q2 (NM_173469) Human Mass Spec Standard

SKU
PH304433
UBE2Q2 MS Standard C13 and N15-labeled recombinant protein (NP_775740)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204433]
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC204433 representing NM_173469
Red=Cloning site Green=Tags(s)

MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIW
FVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEE
EEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLM
KELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPF
DPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLAR
AQQSYNSIVQIHEKNGWYTPPKEDG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775740
RefSeq Size 2939
RefSeq ORF 1125
Locus ID 92912
UniProt ID Q8WVN8
Cytogenetics 15q24.2
Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.[UniProtKB/Swiss-Prot Function]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:UBE2Q2 (NM_173469) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406622 UBE2Q2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428824 UBE2Q2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406622 Transient overexpression lysate of ubiquitin-conjugating enzyme E2Q family member 2 (UBE2Q2), transcript variant 1 100 ug
$436.00
LY428824 Transient overexpression lysate of ubiquitin-conjugating enzyme E2Q family member 2 (UBE2Q2), transcript variant 2 100 ug
$436.00
TP304433 Recombinant protein of human ubiquitin-conjugating enzyme E2Q family member 2 (UBE2Q2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.