SMR3B (NM_006685) Human Mass Spec Standard

SKU
PH304422
SMR3B MS Standard C13 and N15-labeled recombinant protein (NP_006676)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204422]
Predicted MW 8.2 kDa
Protein Sequence
Protein Sequence
>RC204422 protein sequence
Red=Cloning site Green=Tags(s)

MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG
IFPPPPPQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006676
RefSeq Size 798
RefSeq ORF 237
Synonyms P-B; PBII; PRL3; PROL3; SMR1B
Locus ID 10879
UniProt ID P02814
Cytogenetics 4q13.3
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:SMR3B (NM_006685) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416487 SMR3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416487 Transient overexpression lysate of submaxillary gland androgen regulated protein 3B (SMR3B) 100 ug
$436.00
TP304422 Purified recombinant protein of Homo sapiens submaxillary gland androgen regulated protein 3B (SMR3B), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.