Tropomodulin 3 (TMOD3) (NM_014547) Human Mass Spec Standard

SKU
PH304417
TMOD3 MS Standard C13 and N15-labeled recombinant protein (NP_055362)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204417]
Predicted MW 39.6 kDa
Protein Sequence
Protein Sequence
>RC204417 protein sequence
Red=Cloning site Green=Tags(s)

MALPFRKDLEKYKDLDEDELLGNLSETELKQLETVLDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLL
SYLEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGM
HNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKN
IPIPTLKDFAKALETNTHVKCFSLAATRSNDPVATAFAEMLKVNKTLKSLNVESNFITGVGILALIDALR
DNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGD
HQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055362
RefSeq Size 4682
RefSeq ORF 1056
Synonyms UTMOD
Locus ID 29766
UniProt ID Q9NYL9
Cytogenetics 15q21.2
Summary Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Tropomodulin 3 (TMOD3) (NM_014547) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415225 TMOD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415225 Transient overexpression lysate of tropomodulin 3 (ubiquitous) (TMOD3) 100 ug
$436.00
TP304417 Recombinant protein of human tropomodulin 3 (ubiquitous) (TMOD3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.