SGK3 (NM_013257) Human Mass Spec Standard

SKU
PH304416
SGK3 MS Standard C13 and N15-labeled recombinant protein (NP_037389)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204416]
Predicted MW 57.1 kDa
Protein Sequence
Protein Sequence
>RC204416 protein sequence
Red=Cloning site Green=Tags(s)

MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMAL
KIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKL
HSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAE
RNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSI
KIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAV
LYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP
SEDLFL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037389
RefSeq Size 4206
RefSeq ORF 1488
Synonyms CISK; SGK2; SGKL
Locus ID 23678
UniProt ID Q96BR1
Cytogenetics 8q13.1
Summary This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:SGK3 (NM_013257) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406888 SGK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415716 SGK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422403 SGK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406888 Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2 100 ug
$665.00
LY415716 Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1 100 ug
$436.00
LY422403 Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3 100 ug
$665.00
TP304416 Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760266 Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.