beta TRCP2 (FBXW11) (NM_033644) Human Mass Spec Standard

SKU
PH304407
FBXW11 MS Standard C13 and N15-labeled recombinant protein (NP_387448)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204407]
Predicted MW 60.9 kDa
Protein Sequence
Protein Sequence
>RC204407 protein sequence
Red=Cloning site Green=Tags(s)

MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQW
SESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKE
WQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNW
RCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVI
VTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHR
AAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECG
ACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEF
QIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_387448
RefSeq Size 4536
RefSeq ORF 1587
Synonyms BTRC2; BTRCP2; FBW1B; Fbw11; FBXW1B; Hos; NEDJED
Locus ID 23291
UniProt ID Q9UKB1
Cytogenetics 5q35.1
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Hedgehog signaling pathway, Oocyte meiosis, Ubiquitin mediated proteolysis, Wnt signaling pathway
Write Your Own Review
You're reviewing:beta TRCP2 (FBXW11) (NM_033644) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409480 FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409481 FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415862 FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409480 Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 2 100 ug
$436.00
LY409481 Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 1 100 ug
$665.00
LY415862 Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 3 100 ug
$665.00
TP304407 Recombinant protein of human F-box and WD repeat domain containing 11 (FBXW11), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.