OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDC37L1 (NM_017913) Human Mass Spec Standard

Be the first to review this product
SKU
PH304355
CDC37L1 MS Standard C13 and N15-labeled recombinant protein (NP_060383)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349783 Rabbit Polyclonal Anti-CDC37L1 Antibody
100 ul
$205.00
LY402629 Transient overexpression lysate of cell division cycle 37 homolog (S. cerevisiae)-like 1 (CDC37L1) (as WB positive control) 100 ug
$436.00

Other products for "CDC37L1 or NM_017913"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204355
Predicted MW 38.8 kDa
Protein Sequence
Protein Sequence
>RC204355 protein sequence
Red=Cloning site Green=Tags(s)

MEQPWPPPGPWSLPRAEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSVACKWN
LAEAQQKLGSLALHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSF
INQDKRKDTEDEDKSESFMQKYEQKIRHFGMLSRWDDSQRFLSDHPYLVCEETAKYLILWCFHLEAEKKG
ALMEQIAHQAVVMQFIMEMAKNCNVDPRGCFRLFFQKAKAEEEGYFEAFKNELEAFKSRVRLYSQSQSFQ
PMTVQNHVPHSGVGSIGLLESLPQNPDYLQYSISTALCSLNSVVHKEDDEPKMMDTV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060383
RefSeq Size 1724
RefSeq ORF 1011
Synonyms CDC37B; HARC
Locus ID 55664
UniProt ID Q7L3B6
Cytogenetics 9p24.1
Summary CDC37L1 is a cytoplasmic phosphoprotein that exists in complex with HSP90 (HSPCA; MIM 140571) as well as several other proteins involved in HSP90-mediated protein folding (Scholz et al., 2001 PubMed 11413142).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDC37L1" proteins (3)
SKU Description Size Price
LC402629 Lyophilized CDC37L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402629 Transient overexpression lysate of cell division cycle 37 homolog (S. cerevisiae)-like 1 (CDC37L1) (as WB positive control) 100 ug
$436.00
TP304355 Recombinant protein of human cell division cycle 37 homolog (S. cerevisiae)-like 1 (CDC37L1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products