CDC37L1 (NM_017913) Human Mass Spec Standard

SKU
PH304355
CDC37L1 MS Standard C13 and N15-labeled recombinant protein (NP_060383)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204355]
Predicted MW 38.8 kDa
Protein Sequence
Protein Sequence
>RC204355 protein sequence
Red=Cloning site Green=Tags(s)

MEQPWPPPGPWSLPRAEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSVACKWN
LAEAQQKLGSLALHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSF
INQDKRKDTEDEDKSESFMQKYEQKIRHFGMLSRWDDSQRFLSDHPYLVCEETAKYLILWCFHLEAEKKG
ALMEQIAHQAVVMQFIMEMAKNCNVDPRGCFRLFFQKAKAEEEGYFEAFKNELEAFKSRVRLYSQSQSFQ
PMTVQNHVPHSGVGSIGLLESLPQNPDYLQYSISTALCSLNSVVHKEDDEPKMMDTV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060383
RefSeq Size 1724
RefSeq ORF 1011
Synonyms CDC37B; HARC
Locus ID 55664
UniProt ID Q7L3B6
Cytogenetics 9p24.1
Summary CDC37L1 is a cytoplasmic phosphoprotein that exists in complex with HSP90 (HSPCA; MIM 140571) as well as several other proteins involved in HSP90-mediated protein folding (Scholz et al., 2001 [PubMed 11413142]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:CDC37L1 (NM_017913) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402629 CDC37L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402629 Transient overexpression lysate of cell division cycle 37 homolog (S. cerevisiae)-like 1 (CDC37L1) 100 ug
$436.00
TP304355 Recombinant protein of human cell division cycle 37 homolog (S. cerevisiae)-like 1 (CDC37L1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.