MMAB (NM_052845) Human Mass Spec Standard

SKU
PH304290
MMAB MS Standard C13 and N15-labeled recombinant protein (NP_443077)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204290]
Predicted MW 27.4 kDa
Protein Sequence
Protein Sequence
>RC204290 protein sequence
Red=Cloning site Green=Tags(s)

MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSST
FTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHL
KYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVA
KFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443077
RefSeq Size 4154
RefSeq ORF 750
Synonyms ATR; cblB; CFAP23; cob
Locus ID 326625
UniProt ID Q96EY8
Cytogenetics 12q24.11
Summary This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found. [provided by RefSeq, Apr 2011]
Protein Pathways Metabolic pathways, Porphyrin and chlorophyll metabolism
Write Your Own Review
You're reviewing:MMAB (NM_052845) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409455 MMAB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409455 Transient overexpression lysate of methylmalonic aciduria (cobalamin deficiency) cblB type (MMAB), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP304290 Recombinant protein of human methylmalonic aciduria (cobalamin deficiency) cblB type (MMAB), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.