OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAP2B (NM_002886) Human Mass Spec Standard

Be the first to review this product
SKU
PH304287
RAP2B MS Standard C13 and N15-labeled recombinant protein (NP_002877)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358694 RAP2B Antibody - C-terminal region
100 ul
$585.00
LY419033 Transient overexpression lysate of RAP2B, member of RAS oncogene family (RAP2B) (as WB positive control) 100 ug
$436.00

Other products for "RAP2B or NM_002886"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204287
Predicted MW 20.5 kDa
Protein Sequence
Protein Sequence
>RC204287 protein sequence
Red=Cloning site Green=Tags(s)

MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC
PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002877
RefSeq Size 8413
RefSeq ORF 549
Locus ID 5912
UniProt ID P61225
Cytogenetics 3q25.2
Summary This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAP2B" proteins (3)
SKU Description Size Price
LC419033 Lyophilized RAP2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419033 Transient overexpression lysate of RAP2B, member of RAS oncogene family (RAP2B) (as WB positive control) 100 ug
$436.00
TP304287 Recombinant protein of human RAP2B, member of RAS oncogene family (RAP2B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products