PITPNB (NM_012399) Human Mass Spec Standard

SKU
PH304262
PITPNB MS Standard C13 and N15-labeled recombinant protein (NP_036531)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204262]
Predicted MW 31.5 kDa
Protein Sequence
Protein Sequence
>RC204262 protein sequence
Red=Cloning site Green=Tags(s)

MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPA
FVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVH
IDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVE
NFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036531
RefSeq Size 2981
RefSeq ORF 813
Synonyms PI-TP-beta; PtdInsTP; VIB1B
Locus ID 23760
UniProt ID P48739
Cytogenetics 22q12.1
Summary This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Write Your Own Review
You're reviewing:PITPNB (NM_012399) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415778 PITPNB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415778 Transient overexpression lysate of phosphatidylinositol transfer protein, beta (PITPNB) 100 ug
$436.00
TP304262 Recombinant protein of human phosphatidylinositol transfer protein, beta (PITPNB), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.