DHPS (NM_001930) Human Mass Spec Standard

SKU
PH304235
DHPS MS Standard C13 and N15-labeled recombinant protein (NP_001921)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204235]
Predicted MW 41 kDa
Protein Sequence
Protein Sequence
>RC204235 protein sequence
Red=Cloning site Green=Tags(s)

MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI
EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI
KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL
GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII
LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL
VAETFAQKMDAFMHEKNED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001921
RefSeq Size 1361
RefSeq ORF 1107
Synonyms DHS; DS; MIG13; NEDSSWI
Locus ID 1725
UniProt ID P49366
Cytogenetics 19p13.13
Summary This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011]
Write Your Own Review
You're reviewing:DHPS (NM_001930) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH322934 DHPS MS Standard C13 and N15-labeled recombinant protein (NP_037539) 10 ug
$3,255.00
LC400714 DHPS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415606 DHPS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400714 Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 1 100 ug
$436.00
LY415606 Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 3 100 ug
$436.00
TP304235 Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322934 Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720110 Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.