DHPS (NM_001930) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204235] |
Predicted MW | 41 kDa |
Protein Sequence |
Protein Sequence
>RC204235 protein sequence
Red=Cloning site Green=Tags(s) MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL VAETFAQKMDAFMHEKNED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001921 |
RefSeq Size | 1361 |
RefSeq ORF | 1107 |
Synonyms | DHS; DS; MIG13; NEDSSWI |
Locus ID | 1725 |
UniProt ID | P49366 |
Cytogenetics | 19p13.13 |
Summary | This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH322934 | DHPS MS Standard C13 and N15-labeled recombinant protein (NP_037539) | 10 ug |
$3,255.00
|
|
LC400714 | DHPS HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC415606 | DHPS HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400714 | Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 1 | 100 ug |
$436.00
|
|
LY415606 | Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 3 | 100 ug |
$436.00
|
|
TP304235 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP322934 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720110 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.