BTN2A2 (NM_006995) Human Mass Spec Standard

SKU
PH304232
BTN2A2 MS Standard C13 and N15-labeled recombinant protein (NP_008926)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204232]
Predicted MW 59.1 kDa
Protein Sequence
Protein Sequence
>RC204232 protein sequence
Red=Cloning site Green=Tags(s)

MEPAAALHFSLPASLLLLLLLLLLSLCALVSAQFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRW
FRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEA
ILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTA
VIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTASPWMVSMTVILAVFIIFMA
VSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVR
RGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTL
EMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDD
SPIFICPALTGASGVMVPEEGLKLHRVGTHQSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008926
RefSeq Size 3602
RefSeq ORF 1569
Synonyms BT2.2; BTF2; BTN2.2
Locus ID 10385
UniProt ID Q8WVV5
Cytogenetics 6p22.2
Summary Butyrophilin is the major protein associated with fat droplets in the milk. This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is a type I receptor glycoprotein involved in lipid, fatty-acid and sterol metabolism. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:BTN2A2 (NM_006995) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405693 BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416278 BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434155 BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405693 Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 2 100 ug
$436.00
LY416278 Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 1 100 ug
$436.00
LY434155 Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 5 100 ug
$436.00
TP304232 Purified recombinant protein of Homo sapiens butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.