CCDC97 (NM_052848) Human Mass Spec Standard

SKU
PH304219
CCDC97 MS Standard C13 and N15-labeled recombinant protein (NP_443080)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204219]
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC204219 protein sequence
Red=Cloning site Green=Tags(s)

MEAVATATAAKEPDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSGAENAAVSAMLHAV
AASRLPVCSQQQGEPDLTEHEKVAILAQLYHEKPLVFLERFRTGLREEHLACFGHVRGDHRADFYCAEVA
RQGTARPRTLRTRLRNRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLTQEELSARTPTHQPPKP
GSPGRPACPLSNLLLQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLI
LREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443080
RefSeq Size 3344
RefSeq ORF 1029
Locus ID 90324
UniProt ID Q96F63
Cytogenetics 19q13.2
Write Your Own Review
You're reviewing:CCDC97 (NM_052848) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409458 CCDC97 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409458 Transient overexpression lysate of coiled-coil domain containing 97 (CCDC97) 100 ug
$436.00
TP304219 Recombinant protein of human coiled-coil domain containing 97 (CCDC97), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP710187 Purified recombinant protein of Human coiled-coil domain containing 97 (CCDC97), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.