OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC97 (NM_052848) Human Mass Spec Standard

Be the first to review this product
SKU
PH304219
CCDC97 MS Standard C13 and N15-labeled recombinant protein (NP_443080)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333574 Rabbit Polyclonal Anti-CCDC97 Antibody
100 ul
$585.00
LY409458 Transient overexpression lysate of coiled-coil domain containing 97 (CCDC97) (as WB positive control) 100 ug
$436.00

Other products for "CCDC97 or NM_052848"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204219
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC204219 protein sequence
Red=Cloning site Green=Tags(s)

MEAVATATAAKEPDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSGAENAAVSAMLHAV
AASRLPVCSQQQGEPDLTEHEKVAILAQLYHEKPLVFLERFRTGLREEHLACFGHVRGDHRADFYCAEVA
RQGTARPRTLRTRLRNRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLTQEELSARTPTHQPPKP
GSPGRPACPLSNLLLQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLI
LREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443080
RefSeq Size 3344
RefSeq ORF 1029
Locus ID 90324
UniProt ID Q96F63
Cytogenetics 19q13.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC97" proteins (4)
SKU Description Size Price
LC409458 Lyophilized CCDC97 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409458 Transient overexpression lysate of coiled-coil domain containing 97 (CCDC97) (as WB positive control) 100 ug
$436.00
TP304219 Recombinant protein of human coiled-coil domain containing 97 (CCDC97), 20 µg 20 ug
$867.00
TP710187 Purified recombinant protein of Human coiled-coil domain containing 97 (CCDC97), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products