MelanA (MLANA) (NM_005511) Human Mass Spec Standard

SKU PH304190

MLANA MS Standard C13 and N15-labeled recombinant protein (NP_005502)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204190]
• Predicted MW: 13.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC204190 protein sequence; Red=Cloning site Green=Tags(s); ; MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL; TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005502
• RefSeq Size: 1524
• RefSeq ORF: 354
• Synonyms: MART-1; MART1
• Locus ID: 2315
• UniProt ID: Q16655
• Cytogenetics: 9p24.1
• Summary: Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane