IGFBP4 (NM_001552) Human Mass Spec Standard

SKU
PH304188
IGFBP4 MS Standard C13 and N15-labeled recombinant protein (NP_001543)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204188]
Predicted MW 27.9 kDa
Protein Sequence
Protein Sequence
>RC204188 protein sequence
Red=Cloning site Green=Tags(s)

MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY
TPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQ
KHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNF
HPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001543
RefSeq Size 2246
RefSeq ORF 774
Synonyms BP-4; HT29-IGFBP; IBP4; IGFBP-4
Locus ID 3487
UniProt ID P22692
Cytogenetics 17q21.2
Summary This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:IGFBP4 (NM_001552) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419861 IGFBP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419861 Transient overexpression lysate of insulin-like growth factor binding protein 4 (IGFBP4) 100 ug
$436.00
TP304188 Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720301 Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4) 10 ug
$285.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.