OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Glutamine Synthetase (GLUL) (NM_002065) Human Mass Spec Standard

Be the first to review this product
SKU
PH304161
GLUL MS Standard C13 and N15-labeled recombinant protein (NP_002056)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500700 GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4) 100 ul
$447.00
LY400756 Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Glutamine Synthetase or NM_002065"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204161
Predicted MW 42.1 kDa
Protein Sequence
Protein Sequence
>RC204161 protein sequence
Red=Cloning site Green=Tags(s)

MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQS
EGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLM
GTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCE
GISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR
HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS
VTEALIRTCLLNETGDEPFQYKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002056
RefSeq Size 4737
RefSeq ORF 1119
Synonyms GLNS; GS; PIG43; PIG59
Locus ID 2752
UniProt ID P15104
Cytogenetics 1q25.3
Summary The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2014
Protein Pathways Alanine, Arginine and proline metabolism, aspartate and glutamate metabolism, Metabolic pathways, Nitrogen metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Glutamine Synthetase" proteins (14)
SKU Description Size Price
PH304039 GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028228) 10 ug
$3,360.00
PH304238 GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028216) 10 ug
$3,360.00
LC400756 Lyophilized GLUL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422348 Lyophilized GLUL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422357 Lyophilized GLUL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400756 Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422348 Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422357 Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP304039 Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3, 20 µg 20 ug
$737.00
TP304161 Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1, 20 µg 20 ug
$737.00
TP304238 Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2, 20 µg 20 ug
$737.00
TP720579 Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 10 ug
$340.00
TP750165 Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 1, full length, with C-terminal His tag, expressed in E.coli, 50ug 50 ug
$270.00
TP762417 Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 3, full length, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products