Glutamine Synthetase (GLUL) (NM_002065) Human Mass Spec Standard

SKU
PH304161
GLUL MS Standard C13 and N15-labeled recombinant protein (NP_002056)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204161]
Predicted MW 42.1 kDa
Protein Sequence
Protein Sequence
>RC204161 protein sequence
Red=Cloning site Green=Tags(s)

MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQS
EGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLM
GTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCE
GISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR
HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS
VTEALIRTCLLNETGDEPFQYKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002056
RefSeq Size 4737
RefSeq ORF 1119
Synonyms GLNS; GS; PIG43; PIG59
Locus ID 2752
UniProt ID P15104
Cytogenetics 1q25.3
Summary The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]
Protein Pathways Alanine, Arginine and proline metabolism, aspartate and glutamate metabolism, Metabolic pathways, Nitrogen metabolism
Write Your Own Review
You're reviewing:Glutamine Synthetase (GLUL) (NM_002065) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304039 GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028228) 10 ug
$3,255.00
PH304238 GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028216) 10 ug
$3,255.00
LC400756 GLUL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422348 GLUL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422357 GLUL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400756 Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 100 ug
$436.00
LY422348 Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2 100 ug
$436.00
LY422357 Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3 100 ug
$436.00
TP304039 Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3, 20 µg 20 ug
$737.00
TP304161 Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1, 20 µg 20 ug
$737.00
TP304238 Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2, 20 µg 20 ug
$737.00
TP720579 Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 10 ug
$330.00
TP750165 Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 1, full length, with C-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00
TP762417 Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 3, full length, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.