NLE1 (NM_018096) Human Mass Spec Standard

SKU
PH304114
NLE1 MS Standard C13 and N15-labeled recombinant protein (NP_060566)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204114]
Predicted MW 53.3 kDa
Protein Sequence
Protein Sequence
>RC204114 protein sequence
Red=Cloning site Green=Tags(s)

MAAAVADEAVARDVQRLLVQFQDEGGQLLGSPFDVPVDITPDRLQLVCNALLAQEDPLPLAFFVHDAEIV
SSLGKTLESQAVETEKVLDIIYQPQAIFRVRAVTRCTSSLEGHSEAVISVAFSPTGKYLASGSGDTTVRF
WDLSTETPHFTCKGHRHWVLSISWSPDGKKLASGCKNGQILLWDPSTGKQVGRTLAGHSKWITGLSWEPL
HANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQSVTCLRWGGDGLLYSASQDRTIKVWRAHDGVLC
RTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDD
FTLFLWSPAEDKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQI
AWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060566
RefSeq Size 2627
RefSeq ORF 1455
Synonyms NLE
Locus ID 54475
UniProt ID Q9NVX2
Cytogenetics 17q12
Summary Plays a role in regulating Notch activity. Plays a role in regulating the expression of CDKN1A and several members of the Wnt pathway, probably via its effects on Notch activity. Required during embryogenesis for inner mass cell survival (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:NLE1 (NM_018096) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413312 NLE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413312 Transient overexpression lysate of notchless homolog 1 (Drosophila) (NLE1), transcript variant 1 100 ug
$436.00
TP304114 Recombinant protein of human notchless homolog 1 (Drosophila) (NLE1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.