SURF2 (NM_017503) Human Mass Spec Standard

SKU
PH304095
SURF2 MS Standard C13 and N15-labeled recombinant protein (NP_059973)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204095]
Predicted MW 29.6 kDa
Protein Sequence
Protein Sequence
>RC204095 protein sequence
Red=Cloning site Green=Tags(s)

MSELPGDVRAFLREHPSLRLQTDARKVRCILTGHELPCRLPELQVYTRGKKYQRLVRASPAFDYAEFEPH
IVPSTKNPHQLFCKLTLRHINKCPEHVLRHTQGRRYQRALCKYEECQKQGVEYVPACLVHRRRRREDQMD
GDGPRPREAFWEPTSSDEGGAASDDSMTDLYPPELFTRKDLGSTEDGDGTDDFLTDKEDEKAKPPREKAT
DEGRRETTVYRGLVQKRGKKQLGSLKKKFKSHHRKPKSFSSCKQPG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_059973
RefSeq Size 851
RefSeq ORF 768
Synonyms SURF-2
Locus ID 6835
UniProt ID Q15527
Cytogenetics 9q34.2
Summary This gene shares a bidirectional promoter with surfeit 1 (SURF1; GeneID: 6834), which is located on the opposite strand. It encodes a conserved protein that is expressed in a variety of tissues. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:SURF2 (NM_017503) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413741 SURF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413741 Transient overexpression lysate of surfeit 2 (SURF2) 100 ug
$436.00
TP304095 Recombinant protein of human surfeit 2 (SURF2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.