NRBF2 (NM_030759) Human Mass Spec Standard

SKU
PH304061
NRBF2 MS Standard C13 and N15-labeled recombinant protein (NP_110386)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204061]
Predicted MW 32.2 kDa
Protein Sequence
Protein Sequence
>RC204061 representing NM_030759
Red=Cloning site Green=Tags(s)

MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLL
IQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDT
LLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGP
IEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDI
LKGFMNN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_110386
RefSeq Size 1866
RefSeq ORF 861
Synonyms COPR; COPR1; COPR2; NRBF-2
Locus ID 29982
UniProt ID Q96F24
Cytogenetics 10q21.3
Summary May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:NRBF2 (NM_030759) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410731 NRBF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410731 Transient overexpression lysate of nuclear receptor binding factor 2 (NRBF2) 100 ug
$436.00
TP304061 Recombinant protein of human nuclear receptor binding factor 2 (NRBF2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.