IGFBP6 (NM_002178) Human Mass Spec Standard

SKU
PH304060
IGFBP6 MS Standard C13 and N15-labeled recombinant protein (NP_002169)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204060]
Predicted MW 25.3 kDa
Protein Sequence
Protein Sequence
>RC204060 protein sequence
Red=Cloning site Green=Tags(s)

MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQE
CGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRN
PGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRG
PCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002169
RefSeq Size 980
RefSeq ORF 720
Synonyms IBP6
Locus ID 3489
UniProt ID P24592
Cytogenetics 12q13.13
Summary IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:IGFBP6 (NM_002178) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400790 IGFBP6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400790 Transient overexpression lysate of insulin-like growth factor binding protein 6 (IGFBP6) 100 ug
$436.00
TP304060 Recombinant protein of human insulin-like growth factor binding protein 6 (IGFBP6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.