14-3-3 sigma (SFN) (NM_006142) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204045] |
Predicted MW | 27.8 kDa |
Protein Sequence |
Protein Sequence
>RC204045 protein sequence
Red=Cloning site Green=Tags(s) MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN EEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006133 |
RefSeq Size | 1336 |
RefSeq ORF | 744 |
Synonyms | YWHAS |
Locus ID | 2810 |
UniProt ID | P31947 |
Cytogenetics | 1p36.11 |
Summary | This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cell cycle, p53 signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC401850 | SFN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401850 | Transient overexpression lysate of stratifin (SFN) | 100 ug |
$436.00
|
|
TP304045 | Recombinant protein of human stratifin (SFN), 20 µg | 20 ug |
$867.00
|
|
TP720151 | Recombinant protein of human stratifin (SFN) | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.