14-3-3 sigma (SFN) (NM_006142) Human Mass Spec Standard

SKU
PH304045
SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204045]
Predicted MW 27.8 kDa
Protein Sequence
Protein Sequence
>RC204045 protein sequence
Red=Cloning site Green=Tags(s)

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN
EEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK
KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE
DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006133
RefSeq Size 1336
RefSeq ORF 744
Synonyms YWHAS
Locus ID 2810
UniProt ID P31947
Cytogenetics 1p36.11
Summary This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cell cycle, p53 signaling pathway
Write Your Own Review
You're reviewing:14-3-3 sigma (SFN) (NM_006142) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401850 SFN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401850 Transient overexpression lysate of stratifin (SFN) 100 ug
$436.00
TP304045 Recombinant protein of human stratifin (SFN), 20 µg 20 ug
$867.00
TP720151 Recombinant protein of human stratifin (SFN) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.