OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BBLN (NM_024112) Human Mass Spec Standard

Be the first to review this product
SKU
PH304030
C9orf16 MS Standard C13 and N15-labeled recombinant protein (NP_077017)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330729 Rabbit Polyclonal Anti-C9orf16 Antibody
100 ul
$585.00
LY411346 Transient overexpression lysate of chromosome 9 open reading frame 16 (C9orf16) (as WB positive control) 100 ug
$436.00

Other products for "C9orf16 or NM_024112"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204030
Predicted MW 9.1 kDa
Protein Sequence
Protein Sequence
>RC204030 protein sequence
Red=Cloning site Green=Tags(s)

MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEF
QQQLGEAPSDASP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077017
RefSeq Size 723
RefSeq ORF 249
Synonyms EST00098
Locus ID 79095
UniProt ID Q9BUW7
Cytogenetics 9q34.11
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C9orf16" proteins (3)
SKU Description Size Price
LC411346 Lyophilized C9orf16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411346 Transient overexpression lysate of chromosome 9 open reading frame 16 (C9orf16) (as WB positive control) 100 ug
$436.00
TP304030 Recombinant protein of human chromosome 9 open reading frame 16 (C9orf16), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products