TRAX (TSNAX) (NM_005999) Human Mass Spec Standard

SKU
PH304023
TSNAX MS Standard C13 and N15-labeled recombinant protein (NP_005990)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204023]
Predicted MW 33.1 kDa
Protein Sequence
Protein Sequence
>RC204023 protein sequence
Red=Cloning site Green=Tags(s)

MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRT
IFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTR
SLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGD
IDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKT
EMIDQEEGIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005990
RefSeq Size 2667
RefSeq ORF 870
Synonyms C3PO; TRAX
Locus ID 7257
UniProt ID Q99598
Cytogenetics 1q42.2
Summary This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TRAX (TSNAX) (NM_005999) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416944 TSNAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416944 Transient overexpression lysate of translin-associated factor X (TSNAX) 100 ug
$436.00
TP304023 Recombinant protein of human translin-associated factor X (TSNAX), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.