PERP (NM_022121) Human Mass Spec Standard

SKU
PH304012
PERP MS Standard C13 and N15-labeled recombinant protein (NP_071404)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204012]
Predicted MW 21.4 kDa
Protein Sequence
Protein Sequence
>RC204012 protein sequence
Red=Cloning site Green=Tags(s)

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLME
YAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLH
ANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071404
RefSeq Size 4319
RefSeq ORF 579
Synonyms dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW
Locus ID 64065
UniProt ID Q96FX8
Cytogenetics 6q23.3
Summary Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Protein Pathways p53 signaling pathway
Write Your Own Review
You're reviewing:PERP (NM_022121) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411759 PERP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411759 Transient overexpression lysate of PERP, TP53 apoptosis effector (PERP) 100 ug
$436.00
TP304012 Recombinant protein of human PERP, TP53 apoptosis effector (PERP), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.