SF20 (MYDGF) (NM_019107) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204011] |
Predicted MW | 18.8 kDa |
Protein Sequence |
Protein Sequence
>RC204011 protein sequence
Red=Cloning site Green=Tags(s) MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_061980 |
RefSeq Size | 1067 |
RefSeq ORF | 519 |
Synonyms | C19orf10; EUROIMAGE1875335; IL25; IL27; IL27w; R33729_1; SF20 |
Locus ID | 56005 |
UniProt ID | Q969H8 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC402744 | MYDGF HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402744 | Transient overexpression lysate of chromosome 19 open reading frame 10 (C19orf10) | 100 ug |
$436.00
|
|
TP304011 | Recombinant protein of human chromosome 19 open reading frame 10 (C19orf10), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720999 | Purified recombinant protein of Human chromosome 19 open reading frame 10 (C19orf10) | 10 ug |
$180.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.