SF20 (MYDGF) (NM_019107) Human Mass Spec Standard

SKU
PH304011
C19orf10 MS Standard C13 and N15-labeled recombinant protein (NP_061980)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204011]
Predicted MW 18.8 kDa
Protein Sequence
Protein Sequence
>RC204011 protein sequence
Red=Cloning site Green=Tags(s)

MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ
GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE
FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061980
RefSeq Size 1067
RefSeq ORF 519
Synonyms C19orf10; EUROIMAGE1875335; IL25; IL27; IL27w; R33729_1; SF20
Locus ID 56005
UniProt ID Q969H8
Cytogenetics 19p13.3
Summary The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:SF20 (MYDGF) (NM_019107) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402744 MYDGF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402744 Transient overexpression lysate of chromosome 19 open reading frame 10 (C19orf10) 100 ug
$436.00
TP304011 Recombinant protein of human chromosome 19 open reading frame 10 (C19orf10), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720999 Purified recombinant protein of Human chromosome 19 open reading frame 10 (C19orf10) 10 ug
$180.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.