RCN1 (NM_002901) Human Mass Spec Standard

SKU
PH303990
RCN1 MS Standard C13 and N15-labeled recombinant protein (NP_002892)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203990]
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC203990 protein sequence
Red=Cloning site Green=Tags(s)

MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK
TFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEY
KQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLE
TLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDH
AQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002892
RefSeq Size 2529
RefSeq ORF 993
Synonyms HEL-S-84; PIG20; RCAL; RCN
Locus ID 5954
UniProt ID Q15293
Cytogenetics 11p13
Summary Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding. In human endothelial and prostate cancer cell lines this protein localizes to the plasma membrane.[provided by RefSeq, Jan 2009]
Write Your Own Review
You're reviewing:RCN1 (NM_002901) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419027 RCN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419027 Transient overexpression lysate of reticulocalbin 1, EF-hand calcium binding domain (RCN1) 100 ug
$436.00
TP303990 Recombinant protein of human reticulocalbin 1, EF-hand calcium binding domain (RCN1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.