TMPRSS4 (NM_019894) Human Mass Spec Standard

SKU
PH303972
TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_063947)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203972]
Predicted MW 48.2 kDa
Protein Sequence
Protein Sequence
>RC203972 protein sequence
Red=Cloning site Green=Tags(s)

MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF
IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC
RQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGGEE
ASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIE
FNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQV
IDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYT
KVSAYLNWIYNVWKAEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_063947
RefSeq Size 3549
RefSeq ORF 1311
Synonyms CAP2; CAPH2; MT-SP2; TMPRSS3
Locus ID 56649
UniProt ID Q9NRS4
Cytogenetics 11q23.3
Summary This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protease, Transmembrane
Write Your Own Review
You're reviewing:TMPRSS4 (NM_019894) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302384 TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_899070) 10 ug
$3,255.00
PH324725 TMPRSS4 MS Standard C13 and N15-labeled recombinant protein (NP_001077416) 10 ug
$3,255.00
LC405242 TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412678 TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432994 TMPRSS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405242 Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 2 100 ug
$436.00
LY412678 Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 1 100 ug
$436.00
LY432994 Transient overexpression lysate of transmembrane protease, serine 4 (TMPRSS4), transcript variant 5 100 ug
$436.00
TP302384 Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 2, 20 µg 20 ug
$867.00
TP303972 Recombinant protein of human transmembrane protease, serine 4 (TMPRSS4), transcript variant 1, 20 µg 20 ug
$867.00
TP324725 Purified recombinant protein of Homo sapiens transmembrane protease, serine 4 (TMPRSS4), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.