PHYHIPL (NM_032439) Human Mass Spec Standard

SKU
PH303950
PHYHIPL MS Standard C13 and N15-labeled recombinant protein (NP_115815)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203950]
Predicted MW 42.5 kDa
Protein Sequence
Protein Sequence
>RC203950 protein sequence
Red=Cloning site Green=Tags(s)

MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNIKISNITCDSFKISW
EMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVRGHWFLSPRTEYTVAVQTASKQ
VDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAEVIAGRMLKFSVFYRNQHKEYFDYVREHHGNAMQPSV
KDNSGSHGSPISGKLEGIFFSCSTEFNTGKPPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHY
VILVIAPVGSPGDEFCKQRLPQLNSKDNKFLTCTEEDGVLVYHHAQDVILEVIYTDPVDLSLGTVAEITG
HQLMSLSTANAKKDPSCKTCNISVGR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115815
RefSeq Size 3581
RefSeq ORF 1128
Locus ID 84457
UniProt ID Q96FC7
Cytogenetics 10q21.1
Summary May play a role in the development of the central system.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PHYHIPL (NM_032439) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410133 PHYHIPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428337 PHYHIPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410133 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein-like (PHYHIPL), transcript variant 1 100 ug
$436.00
LY428337 Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein-like (PHYHIPL), transcript variant 2 100 ug
$436.00
TP303950 Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein-like (PHYHIPL), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.