PHYHIPL (NM_032439) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203950] |
Predicted MW | 42.5 kDa |
Protein Sequence |
Protein Sequence
>RC203950 protein sequence
Red=Cloning site Green=Tags(s) MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNIKISNITCDSFKISW EMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVRGHWFLSPRTEYTVAVQTASKQ VDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAEVIAGRMLKFSVFYRNQHKEYFDYVREHHGNAMQPSV KDNSGSHGSPISGKLEGIFFSCSTEFNTGKPPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHY VILVIAPVGSPGDEFCKQRLPQLNSKDNKFLTCTEEDGVLVYHHAQDVILEVIYTDPVDLSLGTVAEITG HQLMSLSTANAKKDPSCKTCNISVGR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_115815 |
RefSeq Size | 3581 |
RefSeq ORF | 1128 |
Locus ID | 84457 |
UniProt ID | Q96FC7 |
Cytogenetics | 10q21.1 |
Summary | May play a role in the development of the central system.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC410133 | PHYHIPL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428337 | PHYHIPL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410133 | Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein-like (PHYHIPL), transcript variant 1 | 100 ug |
$436.00
|
|
LY428337 | Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase interacting protein-like (PHYHIPL), transcript variant 2 | 100 ug |
$436.00
|
|
TP303950 | Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein-like (PHYHIPL), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.