MRPL43 (NM_032112) Human Mass Spec Standard

SKU
PH303936
MRPL43 MS Standard C13 and N15-labeled recombinant protein (NP_115488)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203936]
Predicted MW 17.9 kDa
Protein Sequence
Protein Sequence
>RC203936 protein sequence
Red=Cloning site Green=Tags(s)

MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPGVVIYVNSRPC
CVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTF
RGLRPREVQDPAPAQVQAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115488
RefSeq Size 1016
RefSeq ORF 477
Synonyms bMRP36a; L43mt; MRP-L43
Locus ID 84545
UniProt ID Q8N983
Cytogenetics 10q24.31
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene and the gene for a semaphorin class 4 protein (SEMA4G) overlap at map location 10q24.31 and are transcribed in opposite directions. Sequence analysis identified multiple transcript variants encoding at least four different protein isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MRPL43 (NM_032112) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308068 MRPL43 MS Standard C13 and N15-labeled recombinant protein (NP_789762) 10 ug
$3,255.00
LC406120 MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406122 MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410343 MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406120 Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
LY406122 Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 4 100 ug
$436.00
LY410343 Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
TP303936 Recombinant protein of human mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP308068 Recombinant protein of human mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.