MINA53 (MINA) (NM_153182) Human Mass Spec Standard

SKU
PH303931
MINA MS Standard C13 and N15-labeled recombinant protein (NP_694822)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203931]
Predicted MW 52.8 kDa
Protein Sequence
Protein Sequence
>RC203931 protein sequence
Red=Cloning site Green=Tags(s)

MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP
QRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYS
VEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTA
KEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL
STPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDETQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP
LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_694822
RefSeq Size 4875
RefSeq ORF 1395
Synonyms JMJD10; MDIG; MINA; MINA53; NO52; ROX
Locus ID 84864
UniProt ID Q8IUF8
Cytogenetics 3q11.2
Summary MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:MINA53 (MINA) (NM_153182) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407126 MINA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420967 MINA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425769 MINA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407126 Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 2 100 ug
$436.00
LY420967 Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 1 100 ug
$665.00
TP303931 Recombinant protein of human MYC induced nuclear antigen (MINA), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.