MINA53 (MINA) (NM_153182) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203931] |
Predicted MW | 52.8 kDa |
Protein Sequence |
Protein Sequence
>RC203931 protein sequence
Red=Cloning site Green=Tags(s) MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP QRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYS VEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTA KEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL STPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDETQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_694822 |
RefSeq Size | 4875 |
RefSeq ORF | 1395 |
Synonyms | JMJD10; MDIG; MINA; MINA53; NO52; ROX |
Locus ID | 84864 |
UniProt ID | Q8IUF8 |
Cytogenetics | 3q11.2 |
Summary | MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC407126 | MINA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420967 | MINA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC425769 | MINA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY407126 | Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 2 | 100 ug |
$436.00
|
|
LY420967 | Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 1 | 100 ug |
$665.00
|
|
TP303931 | Recombinant protein of human MYC induced nuclear antigen (MINA), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.