Dynein (DYNLL2) (NM_080677) Human Mass Spec Standard

SKU PH303913

DYNLL2 MS Standard C13 and N15-labeled recombinant protein (NP_542408)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203913]
• Predicted MW: 10.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC203913 protein sequence; Red=Cloning site Green=Tags(s); ; MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET; KHFIYFYLGQVAILLFKSG; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_542408
• RefSeq Size: 1522
• RefSeq ORF: 267
• Synonyms: Dlc2; DNCL1B; RSPH22
• Locus ID: 140735
• UniProt ID: Q96FJ2
• Cytogenetics: 17q22
• Summary: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity).[UniProtKB/Swiss-Prot Function]