OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STK3 (NM_006281) Human Mass Spec Standard

Be the first to review this product
SKU
PH303897
STK3 MS Standard C13 and N15-labeled recombinant protein (NP_006272)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500408 Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10) 100 ul
$447.00
LY401892 Transient overexpression lysate of serine/threonine kinase 3 (STE20 homolog, yeast) (STK3) (as WB positive control) 100 ug
$436.00

Other products for "STK3 or NM_006281"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203897
Predicted MW 56.3 kDa
Protein Sequence
Protein Sequence
>RC203897 protein sequence
Red=Cloning site Green=Tags(s)

MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKE
ISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFM
RKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGIT
SIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKN
AKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTM
IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQN
F

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006272
RefSeq Size 2828
RefSeq ORF 1473
Synonyms KRS1; MST2
Locus ID 6788
UniProt ID Q13188
Cytogenetics 8q22.2
Summary This gene encodes a serine/threonine protein kinase activated by proapoptotic molecules indicating the encoded protein functions as a growth suppressor. Cleavage of the protein product by caspase removes the inhibitory C-terminal portion. The N-terminal portion is transported to the nucleus where it homodimerizes to form the active kinase which promotes the condensation of chromatin during apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2012
Protein Families Druggable Genome, Protein Kinase
Protein Pathways MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STK3" proteins (3)
SKU Description Size Price
LC401892 Lyophilized STK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401892 Transient overexpression lysate of serine/threonine kinase 3 (STE20 homolog, yeast) (STK3) (as WB positive control) 100 ug
$436.00
TP303897 Recombinant protein of human serine/threonine kinase 3 (STE20 homolog, yeast) (STK3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products