ARL11 (NM_138450) Human Mass Spec Standard

SKU
PH303868
ARL11 MS Standard C13 and N15-labeled recombinant protein (NP_612459)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203868]
Predicted MW 21.4 kDa
Protein Sequence
Protein Sequence
>RC203868 protein sequence
Red=Cloning site Green=Tags(s)

MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPL
RASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLS
LERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612459
RefSeq Size 3760
RefSeq ORF 588
Synonyms ARLTS1
Locus ID 115761
UniProt ID Q969Q4
Cytogenetics 13q14.2
Summary This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:ARL11 (NM_138450) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408600 ARL11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408600 Transient overexpression lysate of ADP-ribosylation factor-like 11 (ARL11) 100 ug
$436.00
TP303868 Recombinant protein of human ADP-ribosylation factor-like 11 (ARL11), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.