SMNDC1 (NM_005871) Human Mass Spec Standard

SKU PH303791

SMNDC1 MS Standard C13 and N15-labeled recombinant protein (NP_005862)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203791]
• Predicted MW: 26.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC203791 protein sequence; Red=Cloning site Green=Tags(s); ; MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPT; HSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPM; SKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVG; VGTCGIADKPMTQYQDTSKYNVRHLMPQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005862
• RefSeq Size: 2043
• RefSeq ORF: 714
• Synonyms: SMNR; SPF30; TDRD16C
• Locus ID: 10285
• UniProt ID: O75940
• Cytogenetics: 10q25.2
• Summary: This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. [provided by RefSeq, Jul 2008]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome