OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SMNDC1 (NM_005871) Human Mass Spec Standard

Be the first to review this product
SKU
PH303791
SMNDC1 MS Standard C13 and N15-labeled recombinant protein (NP_005862)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345934 Rabbit Polyclonal Anti-SMNDC1 Antibody
100 ul
$585.00
LY417013 Transient overexpression lysate of survival motor neuron domain containing 1 (SMNDC1) (as WB positive control) 100 ug
$436.00

Other products for "SMNDC1 or NM_005871"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203791
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC203791 protein sequence
Red=Cloning site Green=Tags(s)

MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPT
HSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPM
SKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVG
VGTCGIADKPMTQYQDTSKYNVRHLMPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005862
RefSeq Size 2043
RefSeq ORF 714
Synonyms SMNR; SPF30; TDRD16C
Locus ID 10285
UniProt ID O75940
Cytogenetics 10q25.2
Summary This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. provided by RefSeq, Jul 2008
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SMNDC1" proteins (3)
SKU Description Size Price
LC417013 Lyophilized SMNDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417013 Transient overexpression lysate of survival motor neuron domain containing 1 (SMNDC1) (as WB positive control) 100 ug
$436.00
TP303791 Recombinant protein of human survival motor neuron domain containing 1 (SMNDC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products