C5R1 (C5AR1) (NM_001736) Human Mass Spec Standard

SKU
PH303784
C5AR1 MS Standard C13 and N15-labeled recombinant protein (NP_001727)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203784]
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC203784 protein sequence
Red=Cloning site Green=Tags(s)

MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI
NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK
PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG
FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNK
LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001727
RefSeq Size 2342
RefSeq ORF 1050
Synonyms C5A; C5AR; C5R1; CD88
Locus ID 728
UniProt ID P21730
Cytogenetics 19q13.32
Summary Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a (PubMed:1847994, PubMed:8182049, PubMed:7622471, PubMed:9553099, PubMed:10636859, PubMed:15153520, PubMed:29300009). The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events (PubMed:8182049, PubMed:7622471, PubMed:9553099). Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production (PubMed:10636859, PubMed:15153520).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Complement and coagulation cascades, Neuroactive ligand-receptor interaction
Write Your Own Review
You're reviewing:C5R1 (C5AR1) (NM_001736) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400657 C5AR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400657 Transient overexpression lysate of complement component 5a receptor 1 (C5AR1) 100 ug
$436.00
TP303784 Recombinant protein of human complement component 5a receptor 1 (C5AR1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.