VSIG4 (NM_007268) Human Mass Spec Standard

SKU
PH303751
VSIG4 MS Standard C13 and N15-labeled recombinant protein (NP_009199)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203751]
Predicted MW 44 kDa
Protein Sequence
Protein Sequence
>RC203751 protein sequence
Red=Cloning site Green=Tags(s)

MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLR
DSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSV
SKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYF
CTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGK
SLPVFAIILIISLCCMVVFTMAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTS
QNLGNNYSDEPCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009199
RefSeq Size 1869
RefSeq ORF 1197
Synonyms CRIg; Z39IG
Locus ID 11326
UniProt ID Q9Y279
Cytogenetics Xq12
Summary This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for the complement component 3 fragments C3b and iC3b. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:VSIG4 (NM_007268) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416087 VSIG4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420270 VSIG4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416087 Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1 100 ug
$436.00
LY420270 Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 2 100 ug
$436.00
TP303751 Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720454 Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 2 10 ug
$215.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.