OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VSIG4 (NM_007268) Human Mass Spec Standard

Be the first to review this product
SKU
PH303751
VSIG4 MS Standard C13 and N15-labeled recombinant protein (NP_009199)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356148 VSIG4 Antibody - N-terminal region
100 ul
$585.00
LY416087 Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "VSIG4 or NM_007268"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203751
Predicted MW 44 kDa
Protein Sequence
Protein Sequence
>RC203751 protein sequence
Red=Cloning site Green=Tags(s)

MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLR
DSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSV
SKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYF
CTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGK
SLPVFAIILIISLCCMVVFTMAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTS
QNLGNNYSDEPCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009199
RefSeq Size 1869
RefSeq ORF 1197
Synonyms CRIg; Z39IG
Locus ID 11326
UniProt ID Q9Y279
Cytogenetics Xq12
Summary This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for the complement component 3 fragments C3b and iC3b. Alternate splicing results in multiple transcript variants. provided by RefSeq, May 2010
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VSIG4" proteins (6)
SKU Description Size Price
LC416087 Lyophilized VSIG4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420270 Lyophilized VSIG4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416087 Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420270 Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303751 Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1, 20 µg 20 ug
$867.00
TP720454 Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 2 10 ug
$220.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products