RTDR1 (RSPH14) (NM_014433) Human Mass Spec Standard

SKU
PH303725
RTDR1 MS Standard C13 and N15-labeled recombinant protein (NP_055248)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203725]
Predicted MW 38.6 kDa
Protein Sequence
Protein Sequence
>RC203725 protein sequence
Red=Cloning site Green=Tags(s)

MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCME
NLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQVPR
GAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKA
ARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLEL
LHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055248
RefSeq Size 1286
RefSeq ORF 1044
Synonyms RTDR1
Locus ID 27156
UniProt ID Q9UHP6
Cytogenetics 22q11.22-q11.23
Summary This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RTDR1 (RSPH14) (NM_014433) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415282 RSPH14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415282 Transient overexpression lysate of rhabdoid tumor deletion region gene 1 (RTDR1) 100 ug
$436.00
TP303725 Recombinant protein of human rhabdoid tumor deletion region gene 1 (RTDR1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.