AVEN (NM_020371) Human Mass Spec Standard

SKU
PH303707
AVEN MS Standard C13 and N15-labeled recombinant protein (NP_065104)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203707]
Predicted MW 38.5 kDa
Protein Sequence
Protein Sequence
>RC203707 protein sequence
Red=Cloning site Green=Tags(s)

MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGG
APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTD
FSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLE
VPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGD
HLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTE
EELEDWLDSMIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065104
RefSeq Size 1551
RefSeq ORF 1086
Synonyms PDCD12
Locus ID 57099
UniProt ID Q9NQS1
Cytogenetics 15q14
Summary Protects against apoptosis mediated by Apaf-1.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:AVEN (NM_020371) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412513 AVEN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412513 Transient overexpression lysate of apoptosis, caspase activation inhibitor (AVEN) 100 ug
$436.00
TP303707 Recombinant protein of human apoptosis, caspase activation inhibitor (AVEN), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.