OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AVEN (NM_020371) Human Mass Spec Standard

Be the first to review this product
SKU
PH303707
AVEN MS Standard C13 and N15-labeled recombinant protein (NP_065104)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322259 Anti-AVEN Rabbit Polyclonal Antibody
100 ul
$305.00
LY412513 Transient overexpression lysate of apoptosis, caspase activation inhibitor (AVEN) (as WB positive control) 100 ug
$436.00

Other products for "AVEN or NM_020371"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203707
Predicted MW 38.5 kDa
Protein Sequence
Protein Sequence
>RC203707 protein sequence
Red=Cloning site Green=Tags(s)

MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGG
APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTD
FSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLE
VPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGD
HLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTE
EELEDWLDSMIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065104
RefSeq Size 1551
RefSeq ORF 1086
Synonyms PDCD12
Locus ID 57099
UniProt ID Q9NQS1
Cytogenetics 15q14
Summary Protects against apoptosis mediated by Apaf-1.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AVEN" proteins (3)
SKU Description Size Price
LC412513 Lyophilized AVEN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412513 Transient overexpression lysate of apoptosis, caspase activation inhibitor (AVEN) (as WB positive control) 100 ug
$436.00
TP303707 Recombinant protein of human apoptosis, caspase activation inhibitor (AVEN), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products