PAGE5 (NM_130467) Human Mass Spec Standard

SKU PH303636

PAGE5 MS Standard C13 and N15-labeled recombinant protein (NP_569734)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203636]
• Predicted MW: 14 kDa
• Protein Sequence:
  Protein Sequence

  >RC203636 protein sequence; Red=Cloning site Green=Tags(s); ; MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAP; SGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_569734
• RefSeq Size: 760
• RefSeq ORF: 390
• Synonyms: CT16; CT16.1; CT16.2; GAGEE1; PAGE-5
• Locus ID: 90737
• UniProt ID: Q96GU1
• Cytogenetics: Xp11.21
• Summary: This gene is a member of family of proteins that are expressed in a variety of tumors and in some fetal and reproductive tissues. The encoded protein may protect cells from programmed cell death. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jan 2015]