PAGE5 (NM_130467) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC203636] |
Predicted MW | 14 kDa |
Protein Sequence |
Protein Sequence
>RC203636 protein sequence
Red=Cloning site Green=Tags(s) MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAP SGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_569734 |
RefSeq Size | 760 |
RefSeq ORF | 390 |
Synonyms | CT16; CT16.1; CT16.2; GAGEE1; PAGE-5 |
Locus ID | 90737 |
UniProt ID | Q96GU1 |
Cytogenetics | Xp11.21 |
Summary | This gene is a member of family of proteins that are expressed in a variety of tumors and in some fetal and reproductive tissues. The encoded protein may protect cells from programmed cell death. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jan 2015] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC408917 | PAGE5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408917 | Transient overexpression lysate of P antigen family, member 5 (prostate associated) (PAGE5), transcript variant 1 | 100 ug |
$436.00
|
|
TP303636 | Purified recombinant protein of Homo sapiens P antigen family, member 5 (prostate associated) (PAGE5), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.