OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARF6 (NM_001663) Human Mass Spec Standard

Be the first to review this product
SKU
PH303600
ARF6 MS Standard C13 and N15-labeled recombinant protein (NP_001654)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321390 Anti-ARF6 Rabbit Polyclonal Antibody
100 ul
$305.00
LY400629 Transient overexpression lysate of ADP-ribosylation factor 6 (ARF6) (as WB positive control) 100 ug
$436.00

Other products for "ARF6 or NM_001663"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203600
Predicted MW 20.1 kDa
Protein Sequence
Protein Sequence
>RC203600 protein sequence
Red=Cloning site Green=Tags(s)

MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKI
RPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG
LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001654
RefSeq Size 3939
RefSeq ORF 525
Locus ID 382
UniProt ID P62330
Cytogenetics 14q21.3
Summary This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. provided by RefSeq, Jul 2008
Protein Pathways Endocytosis, Fc gamma R-mediated phagocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARF6" proteins (3)
SKU Description Size Price
LC400629 Lyophilized ARF6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400629 Transient overexpression lysate of ADP-ribosylation factor 6 (ARF6) (as WB positive control) 100 ug
$436.00
TP303600 Recombinant protein of human ADP-ribosylation factor 6 (ARF6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products