HPDL (NM_032756) Human Mass Spec Standard

SKU
PH303550
HPDL MS Standard C13 and N15-labeled recombinant protein (NP_116145)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203550]
Predicted MW 39.4 kDa
Protein Sequence
Protein Sequence
>RC203550 protein sequence
Red=Cloning site Green=Tags(s)

MAAPALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLD
PRHAVPSATNLCFDVADAGAATRELAALGCSVPVPPVRVRDAQGAATYAVVSSPAGILSLTLLERAGYRG
PFLPGFRPVSSAPGPGWVSRVDHLTLACTPGSSPTLLRWFHDCLGFCHLPLSPGEDPELGLEMTAGFGLG
GLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQF
LAPPGAYYQQPGKERQIRAAGHEPHLLARQGILLDGDKGKFLLQVFTKSLFTEDTFFLELIQRQGATGFG
QGNIRALWQSVQEQSARSQEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116145
RefSeq Size 1803
RefSeq ORF 1113
Synonyms 4-HPPD-L; GLOXD1
Locus ID 84842
UniProt ID Q96IR7
Cytogenetics 1p34.1
Summary The protein encoded by this intronless gene localizes to mitochondria, where it may function as 4-hydroxyphenylpyruvate dioxygenase. Clinical studies have identified several bi-allelic variants in this gene that lower the level of the encoded protein and lead to a clinically variable form of pediatric-onset spastic movement disorder. [provided by RefSeq, Aug 2020]
Write Your Own Review
You're reviewing:HPDL (NM_032756) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403196 HPDL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403196 Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase-like (HPDL) 100 ug
$436.00
TP303550 Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase-like (HPDL), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.