OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VASP (NM_003370) Human Mass Spec Standard

Be the first to review this product
SKU
PH303544
VASP MS Standard C13 and N15-labeled recombinant protein (NP_003361)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502647 VASP mouse monoclonal antibody, clone OTI4D6 (formerly 4D6) 100 ul
$447.00
LY401150 Transient overexpression lysate of vasodilator-stimulated phosphoprotein (VASP) (as WB positive control) 100 ug
$436.00

Other products for "VASP or NM_003370"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203544
Predicted MW 40.3 kDa
Protein Sequence
Protein Sequence
>RC203544 representing NM_003370
Red=Cloning site Green=Tags(s)

MSSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRG
VKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVE
QQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPP
LPAAQGPGGGGAGAPGLAAAIAGAKLRKVSKEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQV
GEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQE
LLEEVKKELQKVKEEIIEAFVQELRKRGSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003361
RefSeq Size 2298
RefSeq ORF 1140
Locus ID 7408
UniProt ID P50552
Cytogenetics 19q13.32
Summary Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VASP" proteins (3)
SKU Description Size Price
LC401150 Lyophilized VASP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401150 Transient overexpression lysate of vasodilator-stimulated phosphoprotein (VASP) (as WB positive control) 100 ug
$436.00
TP303544 Recombinant protein of human vasodilator-stimulated phosphoprotein (VASP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products