NUDC (NM_006600) Human Mass Spec Standard

SKU
PH303543
NUDC MS Standard C13 and N15-labeled recombinant protein (NP_006591)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203543]
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC203543 protein sequence
Red=Cloning site Green=Tags(s)

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTR
REKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSP
GKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVG
LKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLD
SETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006591
RefSeq Size 1813
RefSeq ORF 993
Synonyms HNUDC; MNUDC; NPD011
Locus ID 10726
UniProt ID Q9Y266
Cytogenetics 1p36.11
Summary This gene encodes a nuclear distribution protein that plays an essential role in mitosis and cytokinesis. The encoded protein is involved in spindle formation during mitosis and in microtubule organization during cytokinesis. Pseudogenes of this gene are found on chromosome 2. [provided by RefSeq, Feb 2012]
Write Your Own Review
You're reviewing:NUDC (NM_006600) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401974 NUDC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401974 Transient overexpression lysate of nuclear distribution gene C homolog (A. nidulans) (NUDC) 100 ug
$436.00
TP303543 Recombinant protein of human nuclear distribution gene C homolog (A. nidulans) (NUDC), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.